CDS

Accession Number TCMCG064C12857
gbkey CDS
Protein Id XP_020549692.1
Location join(16299641..16299698,16299889..16300100)
Gene LOC110012010
GeneID 110012010
Organism Sesamum indicum

Protein

Length 89aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA268358
db_source XM_020694033.1
Definition pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta [Sesamum indicum]

EGGNOG-MAPPER Annotation

COG_category G
Description Catalytic subunit of pyrophosphate--fructose 6-phosphate 1-phosphotransferase. Catalyzes the phosphorylation of D-fructose 6-phosphate, the first committing step of glycolysis. Uses inorganic phosphate (PPi) as phosphoryl donor instead of ATP like common ATP-dependent phosphofructokinases (ATP-PFKs), which renders the reaction reversible, and can thus function both in glycolysis and gluconeogenesis
KEGG_TC -
KEGG_Module -
KEGG_Reaction R00764        [VIEW IN KEGG]
R02073        [VIEW IN KEGG]
KEGG_rclass RC00017        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
KEGG_ko ko:K00895        [VIEW IN KEGG]
EC 2.7.1.90        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko00010        [VIEW IN KEGG]
ko00030        [VIEW IN KEGG]
ko00051        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko01110        [VIEW IN KEGG]
ko01120        [VIEW IN KEGG]
ko01130        [VIEW IN KEGG]
map00010        [VIEW IN KEGG]
map00030        [VIEW IN KEGG]
map00051        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map01110        [VIEW IN KEGG]
map01120        [VIEW IN KEGG]
map01130        [VIEW IN KEGG]
GOs GO:0000003        [VIEW IN EMBL-EBI]
GO:0003006        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005618        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0005975        [VIEW IN EMBL-EBI]
GO:0006793        [VIEW IN EMBL-EBI]
GO:0006796        [VIEW IN EMBL-EBI]
GO:0007275        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008443        [VIEW IN EMBL-EBI]
GO:0009719        [VIEW IN EMBL-EBI]
GO:0009725        [VIEW IN EMBL-EBI]
GO:0009735        [VIEW IN EMBL-EBI]
GO:0009790        [VIEW IN EMBL-EBI]
GO:0009791        [VIEW IN EMBL-EBI]
GO:0009793        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010033        [VIEW IN EMBL-EBI]
GO:0010035        [VIEW IN EMBL-EBI]
GO:0010038        [VIEW IN EMBL-EBI]
GO:0010154        [VIEW IN EMBL-EBI]
GO:0015979        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016301        [VIEW IN EMBL-EBI]
GO:0016310        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016772        [VIEW IN EMBL-EBI]
GO:0016773        [VIEW IN EMBL-EBI]
GO:0019200        [VIEW IN EMBL-EBI]
GO:0022414        [VIEW IN EMBL-EBI]
GO:0030312        [VIEW IN EMBL-EBI]
GO:0032501        [VIEW IN EMBL-EBI]
GO:0032502        [VIEW IN EMBL-EBI]
GO:0042221        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044262        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046686        [VIEW IN EMBL-EBI]
GO:0046835        [VIEW IN EMBL-EBI]
GO:0047334        [VIEW IN EMBL-EBI]
GO:0048316        [VIEW IN EMBL-EBI]
GO:0048608        [VIEW IN EMBL-EBI]
GO:0048731        [VIEW IN EMBL-EBI]
GO:0048856        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0061458        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071944        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTTAGAGATTATATCACAGATGTTTTCTGTAAACGTGCTGAGAATAGTTACAACTAAATTGATTGCAGAGCTGAATGAAATCCTCTCACATGATGTTGTTGATGAAGGTGGAATGTGGAAAAAGAAACTGGGGAGCCAATCTCTCAAGCTTTTTGAAATCTTACCACAAGCCATTCAGGAGCAGTTGCTGCTGGAAAGAGATCCACATGGAAATGTGCAGGTAATCATGCTATTGGTTGAATGGATATCCATTGATTACATAAGTTAA
Protein:  
MLEIISQMFSVNVLRIVTTKLIAELNEILSHDVVDEGGMWKKKLGSQSLKLFEILPQAIQEQLLLERDPHGNVQVIMLLVEWISIDYIS